SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013982 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013982
Domain Number 1 Region: 144-450
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-95
Family Protein kinases, catalytic subunit 0.000000000112
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-22
Family Pleckstrin-homology domain (PH domain) 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013982   Gene: ENSCPOG00000015504   Transcript: ENSCPOT00000015656
Sequence length 478
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:10434171:10667978:-1 gene:ENSCPOG00000015504 transcript:ENSCPOT00000015656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGEAVFHLSRE
RVSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAA
TMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILME
DIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPP
FKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences ENSCPOP00000013982 10141.ENSCPOP00000013982 ENSCPOP00000013982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]