SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014682 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014682
Domain Number 1 Region: 3-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014682   Gene: ENSCPOG00000021859   Transcript: ENSCPOT00000021840
Sequence length 40
Comment pep:novel scaffold:cavPor3:scaffold_3:45429691:45429810:1 gene:ENSCPOG00000021859 transcript:ENSCPOT00000021840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDDSDESLDI
Download sequence
Identical sequences F1P7V9
10141.ENSCPOP00000014682 9615.ENSCAFP00000033639 ENSCPOP00000014682 ENSCPOP00000014682 ENSCAFP00000033639 ENSCAFP00000033639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]