SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Cavia porcellus 76_3 > ENSCPOP00000014881

Domain assignment for ENSCPOP00000014881 from Cavia porcellus 76_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCPOP00000014881
Domain Number 1	Region: 49-107
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000000000139
Family	Classic zinc finger, C2H2	0.015
Further Details:

Domain Number 2	Region: 187-237
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.0000000000166
Family	Classic zinc finger, C2H2	0.01
Further Details:

Domain Number 3	Region: 94-138
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.0000000276
Family	Classic zinc finger, C2H2	0.013
Further Details:

Domain Number 4	Region: 128-178
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000463
Family	Classic zinc finger, C2H2	0.013
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCPOP00000014881 Gene: ENSCPOG00000020173 Transcript: ENSCPOT00000027468
Sequence length	496
Comment	pep:known_by_projection scaffold:cavPor3:scaffold_8:944033:948731:1 gene:ENSCPOG00000020173 transcript:ENSCPOT00000027468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSL PHPEQKPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTH DPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFENTQALLEHLKAHSR RVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKK SHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMASRDVMGAKAFPGMLPMGMYGA HIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPPQLPPKYQLGSTSYLPDKLPKVEVD SFLAELPGSLSLSSAEPQPSSPQPAAAAALLDEALLTKSPANLSEALCAANVDFSHLLGF LPLNLPPCNPPGTTGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFT SGLSTTTLPRFHQAFQ
Download sequence
Identical sequences	H0VW03 XP_003476611.1.53824 ENSCPOP00000014881 ENSCPOP00000014881 10141.ENSCPOP00000014881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]