SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015187 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015187
Domain Number 1 Region: 452-533
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.82e-17
Family Canonical RBD 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000015187
Domain Number - Region: 348-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000111
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015187   Gene: ENSCPOG00000026039   Transcript: ENSCPOT00000025116
Sequence length 750
Comment pep:known_by_projection scaffold:cavPor3:scaffold_11:4675791:4704955:-1 gene:ENSCPOG00000026039 transcript:ENSCPOT00000025116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAAKLLDKTPFSVRNPNPLLPSPASLQLAQLQAQLTLHRLKLAQTAVTNNTAAATVLNQV
LSKVAMSQPLFNQLRHPPVLSAPPGHAAVPQHAATITSAQFPSNAMAFSPPSQTRGPGPS
VSLPSQPPSAIVMHPFGGVMAQTPAQPAVILGIGKAGPAPATTGFYEYGKANATQVYGSE
TDGQPGFLPASASASGSMAYEGHYSHTGQDSQAAFSKDFYGPSAPGSNVAGGFPAEQAGS
MKSEMGPLLQGTNSQWESPPGFSGQSKADLTTGANLWPPPPSQPYELYDPEEPTADRTSP
SFGARLNHSKQGFSGARRRPKEEQARPSMRPLQAHELNDLRGVTPLHLPHICSICDKKVF
DLKDWELHVKGKLHAQKCLVFSEHAGIRCVLTSAEGTLCASPNNTAVYNPAGNEDYASNL
GTSFAAIPARSFAQSNPAFPSAASGTNFAQRKGAGRVVHICNLPEGSCTENDVINLGLPF
GKVTNYILMKSTNQAFLEMAYTEAAQAMVQYYQEKSAVINGEKLLIRMSKRYKELQLKKP
GKTVAAIIQDIHSQRERDMFRETDRYGPERPRSRSPVSRSLSPSSSHSPPGPSRADWGNG
RDSWEHSPYAWREEERDPLPWRENGEDKRDRTDAWAHDRKHYPRPLDKAEPDERPEAGRG
HREKYLRAGSPSPLHSVSSYKCREDGYSRKELKTKSEKYVKQQDGPGRSRRKEEARLRDS
RHPHPDDSGKEDGLGPKVTRTPEGTKSKQS
Download sequence
Identical sequences 10141.ENSCPOP00000015187 ENSCPOP00000015187 ENSCPOP00000015187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]