SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015368 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015368
Domain Number 1 Region: 78-191
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 9.42e-25
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 276-331
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.96e-17
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0055
Further Details:      
 
Domain Number 3 Region: 193-261
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000000183
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000015368
Domain Number - Region: 416-471
Classification Level Classification E-value
Superfamily EF-hand 0.015
Family Calbindin D9K 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015368   Gene: ENSCPOG00000019836   Transcript: ENSCPOT00000026694
Sequence length 866
Comment pep:novel scaffold:cavPor3:scaffold_30:6754956:6802697:-1 gene:ENSCPOG00000019836 transcript:ENSCPOT00000026694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVKQTKTSKDNGDKSSRSPSSFSDNPELSKQDTNIPRQEISPVAVQPLEVPIEPEMIQED
EDTTQYEEPILTKLIVERYEGEKVCGLYEGEGFAVFQGGSTYHGLFSEGLMHGQGTYIWA
DGLKYEGDFVKNMPMNHGVYTWPDGSRYEGEVIDGLRNGFGVFRCSTRPVSYIGLWCHGT
RHGKGSIYYNQEGTSWYKGDWVHNIRKGWGTRCYKSGNIYEGQWEDNMRHGEGKMSWLTT
KEEYEGHWDRGVQNGFGTHKWFIKRILNSQYPLRNEYIGEFVNGCRHGRGKFYYASGAVY
EGEWVCNKKHGMGRFTFKNGRVYEGLFSNDHIAQFVSPDEDVQSYLDLHAKAARTGRQHR
PSVSADMIRKLEGTESPSTMGLSMELDLSLLVNMYPKEEQAEEKKQVEYALLRNISELRR
IYSFYSSLGYDHSPDNTFLMTKLHFWRFLKDCKFHHHKITLADMDRILSASNDIPVEEIH
SPFGTILLRTFLSYLLQLAYHIHHKEYQNRSPSLFLCFTKLMTENIHPNACQVKGNLFSE
GALCTMSYVDKCWEIYRAYSRPNTAPPGELTMKMRHFLWMLKDFKMINKELSATKFVAVI
AEDNPSYMMEIDSNLNVQLVFLEFFEALISFSLICVPYQRTAFSLNDDLSGNRYESAQIL
INQSAPIKTSSAVRSQESDIIHFTRTKSSSSKLGLASDSKVGKFEKMPKPQIKKFLCDDK
SSKMNSKPAEKGMAFACENEKYEKPKEDQKEKLTTWDNNMHAFFMHTFFQAYKHQQMLEE
KVKEHRVQEAALVQQRKAENEELEARLSILREEEAKKQDLENIDITVLQESMDFPTSFPP
RMPSPLKEDSAISQTTKSTPSKKKKK
Download sequence
Identical sequences ENSCPOP00000015368 ENSCPOP00000015368 10141.ENSCPOP00000015368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]