SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015693 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015693
Domain Number 1 Region: 29-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-73
Family Ephrin receptor ligand binding domain 0.000000941
Further Details:      
 
Domain Number 2 Region: 607-778
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-50
Family Protein kinases, catalytic subunit 0.000000196
Further Details:      
 
Domain Number 3 Region: 325-530
Classification Level Classification E-value
Superfamily Fibronectin type III 4.5e-41
Family Fibronectin type III 0.0000742
Further Details:      
 
Domain Number 4 Region: 253-317,363-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000426
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015693   Gene: ENSCPOG00000004938   Transcript: ENSCPOT00000024945
Sequence length 783
Comment pep:known_by_projection scaffold:cavPor3:scaffold_34:20322508:20648109:1 gene:ENSCPOG00000004938 transcript:ENSCPOT00000024945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCHLSILLLLGYSLFSCCGELSLQPSNEVNLLDSKTIQGELGWISYPAHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCDAGYEERGFVCQACRPGFYKAADGNMKCAKCPPHSSTNEEG
SMNCRCENNYFRADKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDITFN
ILCKKCGWNVQQCEPCSPNVHFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAINGVSELSS
APRQFAAVSITTNQAAPSPVMTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTTYVFQIRARTAAGYGSNSRKFEFETSPDSFSISGENS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYNKSKHGADEKRLHFGNGHLKLPGLRTYVDP
HTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGY
TEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAY
TTR
Download sequence
Identical sequences ENSCPOP00000004446 ENSCPOP00000015693 10141.ENSCPOP00000015693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]