SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016020 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016020
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.13e-20
Family Ribosomal protein L24e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016020   Gene: ENSCPOG00000019941   Transcript: ENSCPOT00000027822
Sequence length 157
Comment pep:novel scaffold:cavPor3:scaffold_35:3750691:3754446:-1 gene:ENSCPOG00000019941 transcript:ENSCPOT00000027822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK
KGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQ
ASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Download sequence
Identical sequences G1LAN3 M3YJY7 W5QAY7
10141.ENSCPOP00000016020 9615.ENSCAFP00000014113 ENSAMEP00000003956 ENSCPOP00000016020 ENSMPUP00000011644 ENSMPUP00000011644 ENSOARP00000019882 ENSSSCP00000012733 ENSAMEP00000003956 ENSCPOP00000016020 ENSSSCP00000012733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]