SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016607 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016607
Domain Number 1 Region: 360-462
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 171-225,252-267,295-313
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-16
Family BphP N-terminal domain-like 0.054
Further Details:      
 
Domain Number 3 Region: 89-172
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 570-733
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000000118
Family Tetraviridae-like VP 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016607   Gene: ENSCPOG00000014578   Transcript: ENSCPOT00000024909
Sequence length 788
Comment pep:known scaffold:cavPor3:scaffold_2:11828332:11866162:-1 gene:ENSCPOG00000014578 transcript:ENSCPOT00000024909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNCNPEMTSDVPSLGPSIASGNPGPGIQGGGAIVQRAIKRRPGRLDQISSGGNNCVSFRC
DDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSAL
ARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCE
TGRVVYVSDSVTPVLSQPQSEWFGSTLYDQVHPDDVDKLREQLSTSESALTGRILDLKTG
TVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDPVSMNRLSFVRNRCRNGLGSVKDGEPH
FVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTE
FISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQV
LSVMFRFRSKTREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTVQRS
QLGSTANLPLEMGSGQLAPRQQQQQTELDMVSGRDGLASYNHSQVSVQPVASTGPEHSKT
LEKSDVLFAQDRDPRFSEIYSNINADQSKGISSSTVPATQQLFSQGNSFPPNPRPAENFR
NSGLAPSVTIVQPSSSAGQILAQISRHSNPSQGAAPTWTPSTRSGFSAQQVATQATAKTR
SSQFGVGNFQTPSSFSPMSLPGAPTASPGAATYPTLTNRGSNFAPEAGQTAGQFQTRTAE
GVGVWPQWQGQQPHHRSSSSEQHVQQPSAQQPSQPEVFQEMLSMLGDQSNSYNNEEFPDL
AMFPSFSE
Download sequence
Identical sequences ENSCPOP00000013135 10141.ENSCPOP00000016607 ENSCPOP00000016607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]