SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016782 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016782
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000123
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016782   Gene: ENSCPOG00000009171   Transcript: ENSCPOT00000009254
Sequence length 79
Comment pep:known_by_projection scaffold:cavPor3:scaffold_18:23427399:23429151:1 gene:ENSCPOG00000009171 transcript:ENSCPOT00000009254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGFGKLEHFSGAVYEGQFKDNMFHGLGTYTFPTGAKYTGNFNENRVEGEGEYTDTQGLQ
WSGNFHFTAAPGLRLKLYM
Download sequence
Identical sequences A0A286XCR1
ENSCPOP00000016782 ENSCPOP00000016782 10141.ENSCPOP00000016782 XP_003472963.2.53824 XP_004627690.1.9945 XP_013011332.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]