SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016855 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016855
Domain Number 1 Region: 58-166
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 191-293
Classification Level Classification E-value
Superfamily SRCR-like 8.63e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000916
Further Details:      
 
Domain Number 3 Region: 472-573
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 4 Region: 346-450
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016855   Gene: ENSCPOG00000023791   Transcript: ENSCPOT00000020951
Sequence length 574
Comment pep:known_by_projection scaffold:cavPor3:scaffold_30:1882520:1891060:-1 gene:ENSCPOG00000023791 transcript:ENSCPOT00000020951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVHKEAEIGIRILGPQPDEMSMGWRPEDGGAAPLPLPPALSFLLLLPLASALQPTLLPLP
ELRLVGGPSRCRGRLEVLHSGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQG
RGPILLDNVECRGQEMALSECGSRGWGVHNCFHYEDVAVLCNEFLPTQPPTRKMLTGRAP
PTTPQNGRGEGSVRLIGGAGPCQGRVEILHSGVWGTVCDDDWGLPDAAVVCRQLGCGTAL
AATTNAFFGYGTGHILLDNVHCEGSEPRLAACLSLGWGVHNCGHHEDAGVLCAVLGPPTL
TALPPSATREDGSWHTEPAATGVGAHPSGETTLLTTAAWALGKKSGRLRLVGGPGPCRGR
VEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGT
EARLSDCFHLGWGQHNCGHHEDAGALCAGPEEQVQQDGSETTRAPTPHPRDGHLRLASGT
HRCEGRVELFLGQRWGTICDDAWDMRAASVLCRQLGCGQPLAAPGEAHFGPGRGPILLDN
VKCRGDESTLLLCSHIRWDAHNCDHSEDASVLCQ
Download sequence
Identical sequences ENSCPOP00000016855 ENSCPOP00000016855 10141.ENSCPOP00000016855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]