SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017451 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017451
Domain Number 1 Region: 10-120
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.97e-29
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017451   Gene: ENSCPOG00000026497   Transcript: ENSCPOT00000024090
Sequence length 146
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:31281405:31284448:-1 gene:ENSCPOG00000026497 transcript:ENSCPOT00000024090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGS
RYEGEFAQGKFNGVGVFIRHDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNK
LLRREKCSAVVQRAQSASKSARDLTA
Download sequence
Identical sequences A0A286XA08
10141.ENSCPOP00000017451 ENSCPOP00000017451 XP_003479823.1.53824 XP_005008108.1.53824 XP_005008109.1.53824 XP_005008110.1.53824 ENSCPOP00000017451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]