SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017505 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017505
Domain Number 1 Region: 136-310
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.09e-22
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.008
Further Details:      
 
Domain Number 2 Region: 85-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000687
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017505   Gene: ENSCPOG00000025162   Transcript: ENSCPOT00000022324
Sequence length 342
Comment pep:known_by_projection scaffold:cavPor3:scaffold_52:7854962:7868861:1 gene:ENSCPOG00000025162 transcript:ENSCPOT00000022324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEVMASAFRGLRLWRLAPSGWANWRCIATSPAAQLSLTEMTEMRNHLFNKEKKRQLSLTP
RTEKIEVKHVGKTDPGAVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDRDPTEVNKAYWRSCAMMMGCVIERAFKDEYMVSLVRAPEVPVGIAVIA
GAFCYDVVLDKRLDEWIPTKENLRSFTKDAHALIYKDLPFETLEVEAKVALEIFQHNKYK
IDFIEEKASQNPERIVKLHRIGDFIDMSEGPLIPRTSTCFQYEVSAVHNLQPTQPCLVRR
FQGLSLPVHLRAHFTLWDKLLERSRKMVSEDQTKPTEESAST
Download sequence
Identical sequences ENSCPOP00000017505 10141.ENSCPOP00000017505 ENSCPOP00000017505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]