SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017823 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017823
Domain Number 1 Region: 48-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 1-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000911
Family EGF-type module 0.019
Further Details:      
 
Domain Number 3 Region: 83-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017823   Gene: ENSCPOG00000025822   Transcript: ENSCPOT00000027381
Sequence length 125
Comment pep:novel scaffold:cavPor3:scaffold_100:1337872:1350987:1 gene:ENSCPOG00000025822 transcript:ENSCPOT00000027381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECADKLVLCGHHCVNSVGSFTCVHHSGWELGANGKECHRIELEIVNRCEKNNGGCSHLCE
HAVGRPLCSCNHGHQLDSDGKTCIDADELEKGEACCAQLCVNCLAVFECSCQEGFVIGSD
GRGCD
Download sequence
Identical sequences ENSCPOP00000017823 ENSCPOP00000017823 10141.ENSCPOP00000017823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]