SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018045 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018045
Domain Number 1 Region: 116-317
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 7.04e-18
Family Hypothetical protein TM0207 0.065
Further Details:      
 
Domain Number 2 Region: 20-123
Classification Level Classification E-value
Superfamily ISP domain 0.000000000000055
Family Ring hydroxylating alpha subunit ISP domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018045   Gene: ENSCPOG00000026950   Transcript: ENSCPOT00000023341
Sequence length 578
Comment pep:novel scaffold:cavPor3:scaffold_38:19303398:19358326:-1 gene:ENSCPOG00000026950 transcript:ENSCPOT00000023341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDSLKQTTETLLCLSPVEVANLKEGINFFRNKSTGKDYILYKSKGHLKACKNLCKHQGG
LFIKDIEDLDGRSVKCTKHNWKLDVSTMKYINPPGSFCQDELVVEMDENNGLLLLELNPP
NPWDSDPRSPEDLAFGEVQVTYLTHACMDLKLGDKRMVFDPWLIGPAFARGWWLLHEPPS
DWLERLCKADLIYISHMHSDHLSYPTLKKLSERRQDIPIYVGDTERPVFWNLNQSGVPLT
NINVVPFGIWQQVDKNLRFMILMDGVHPEMDTCIIVEYKGHKILNTVDCTRPNGGRLPAK
VALMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKTERKKLLNYKAQLVKDLQPRIYCPFA
GYFVESHPSDKYIKETNTKNDPNQLNNLIKKNSDIITWTPRPGATLDLGRLLKDPTDSKG
ILEPPEGTKIYKDSWDFEPYLNTLNAAVEDEIFLHSSWIKEYFTWAGFKNYNLVVRMIET
DEDFNPFPGGYDYLVDFLDLSFPKERPSREHPYEEIRSRVDVIRYVVKNGLLWDDLYIGF
QTRLQRDPDIYHHLFWNHFQIKLPLTPPNWRSFLVHCG
Download sequence
Identical sequences H0W4Z4
ENSCPOP00000018045 ENSCPOP00000018045 10141.ENSCPOP00000018045 XP_013006865.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]