SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019074 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019074
Domain Number 1 Region: 412-713
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.27e-72
Family Protein kinases, catalytic subunit 0.000000393
Further Details:      
 
Domain Number 2 Region: 252-369
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-34
Family Kringle modules 0.00028
Further Details:      
 
Domain Number 3 Region: 36-124
Classification Level Classification E-value
Superfamily Immunoglobulin 9.42e-22
Family I set domains 0.028
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000019074
Domain Number - Region: 142-229
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0262
Family Frizzled cysteine-rich domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019074   Gene: ENSCPOG00000021707   Transcript: ENSCPOT00000023955
Sequence length 911
Comment pep:known_by_projection scaffold:cavPor3:scaffold_47:13872276:13907801:1 gene:ENSCPOG00000021707 transcript:ENSCPOT00000023955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEVEMPDPSDPLGYLDGQEGPIPTLKGYYLNFLEPVNNITIVQGQTAILHCKVAGNPPPN
VRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGVKTITATGVLYV
RLGPTHSPNHNFQDDYQEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTM
IGTSTHLSDQCSQFAIPSFCHFVFPLCDSRSRAPKPRELCRDECEVLESDLCRQEYTIAR
SNPLILMRLQLPKCEALPMPESPDAANCMRIGIPVEKLGRYHQCYNGSGSDYRGTASTTR
SGHQCQPWALQHPHGHQLSSVDFPELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVP
SCSPRDSSKLGILYILVPSITIPLVIACLFFLVCVCRNKQKASVASPQRRQLMVSPSQDM
ELPLISQHKQAKLKEINLSTVRFMEELGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDK
AEGPLREEFRHEAMLRARLQHPNIICLLGIVTKDQPLSMIFSYCPHGDLHEFLVMRSPHS
DVGSTDDDRTVKSALEPPDFVHVAAQIAAGMEYLASHHVVHKDLATRNVLVYDKLTVKIS
DLGLFREVYSADYYKLMGNSLLPIRWMSPEAIAYGKFSIDSDIWSYGVVLWEVFSYGLQP
YCGYSNQDVVEMIRTRQVLPCPDDCPAWVYALMLECWSELPSRRPRFKDIHSRLRAWGNL
SSYNSSAQTSGASNTTQTSSLSTSPVSNVSNTRYVGPKQKAQPFPQPQFIPMKGQIRPLV
PPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQIVPKPSSHHSGSGSTSTG
YVTTAPSNTSVADRAALLSEGTEDTQNIPEDVAQSPVQEVEEEEGGSVPETELLGDSDTL
QVDDTQVQLEA
Download sequence
Identical sequences 10141.ENSCPOP00000019074 ENSCPOP00000019074 ENSCPOP00000019074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]