SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019076 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019076
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000197
Family EGF-type module 0.055
Further Details:      
 
Domain Number 2 Region: 450-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 403-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000464
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000019076
Domain Number - Region: 25-43,93-173
Classification Level Classification E-value
Superfamily Sialidases 0.000226
Family Endo-alpha-sialidase 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019076   Gene: ENSCPOG00000024399   Transcript: ENSCPOT00000022206
Sequence length 512
Comment pep:known_by_projection scaffold:cavPor3:scaffold_27:1435561:1481961:-1 gene:ENSCPOG00000024399 transcript:ENSCPOT00000022206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLPLLLRCLSLASADYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPKGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDREDEGLATYWQSVTWSRYPSPLE
ANITLSWNKSVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMAAR
RARDMSPSGAHRVLCTEEYSRWAGSKKEKQVRFEVRDRFAIFAGPELRNMGNLYARLESA
KGLKDFFTFTDLRVRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHASLCSVRE
GSLQCECEHNTTGPDCGKCKRNFRTRAWRAGSYLPLPHGSPNACAAAGSAFGNCECYGHS
NRCSYIDFLNVVTCVSCKHNTRRLGYYRNGSAELDDENVCIECNCNQIGSAHDRCNETGF
CECREGAVGPKCDDCLPTHHWRQGCYPNVCDDDQLLCLNGGTCLQNQRCACPRGYTGLRC
EQPRCDPADDDGGLDCVLGCLLGLGLATRLGR
Download sequence
Identical sequences ENSCPOP00000019076 ENSCPOP00000019076 10141.ENSCPOP00000019076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]