SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019223 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019223
Domain Number 1 Region: 5-222
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.15e-50
Family LplA-like 0.0000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019223   Gene: ENSCPOG00000025073   Transcript: ENSCPOT00000027451
Sequence length 230
Comment pep:known_by_projection scaffold:cavPor3:scaffold_103:1057083:1058247:1 gene:ENSCPOG00000025073 transcript:ENSCPOT00000027451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPAVRVLWLGRLHYAELLGLQERWLRRMQAEPGTEPLGAEAGALLLCEPAGPVYTAGL
RGGLTPEETARLRALGAEVHATGRGGLATFHGPGQLLCHPVLDLRHLGLRLRTHVAALEA
CAVRLCELLGLRGVRARPPPYTGVWLGECKICAIGVRCGRHITSHGLALNCSTDLTWFEH
IVPCGLVGTGVTSLSKELQRRVTVDEVMSPFLMAFEETYKCTLVSEDSLN
Download sequence
Identical sequences ENSCPOP00000019223 ENSCPOP00000019223 10141.ENSCPOP00000019223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]