SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019352 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019352
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.05e-41
Family Galectin (animal S-lectin) 0.00000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019352   Gene: ENSCPOG00000024112   Transcript: ENSCPOT00000026405
Sequence length 136
Comment pep:novel scaffold:cavPor3:scaffold_52:12339671:12341379:1 gene:ENSCPOG00000024112 transcript:ENSCPOT00000026405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQNVPHKTSLPGGVRAGTVVKIRGLVPENAGRFHVNLLLSDGPEADAALHFNPRLDEGVV
VLNSKDKGKWGREERGVGLPFQRGQPFDLLLIATEEGFKAVVGDGVCHHFQHRLPMGNIQ
MLEVAGDVKLDFLRVL
Download sequence
Identical sequences 10141.ENSCPOP00000019352 ENSCPOP00000019352 ENSCPOP00000019352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]