SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019516 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019516
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-79
Family BAR domain 0.0000000188
Further Details:      
 
Domain Number 2 Region: 296-345
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000104
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019516   Gene: ENSCPOG00000023236   Transcript: ENSCPOT00000019934
Sequence length 350
Comment pep:known_by_projection scaffold:cavPor3:scaffold_509:149476:151897:1 gene:ENSCPOG00000023236 transcript:ENSCPOT00000019934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVAEVLVRTIEYLQPNPASRAKLTMLNTV
SKIRGQVKNPGYPQSEGLLGECMVRHGRELGGESNFGDALLDAGESMKRLAEVKDSLDIE
VKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQASEKFEESK
EVAETSMHNLLETDVEQVSQLSALVDAQLDYHRQAVQILEELAEKLKRRVREASSRPRRE
YKPKPREPYDLGEPEQSNGGFPCAPAPKATAPSSSSFRSSDNKPIRTPSRSMPLDQPSCK
ALYDFEPENDGELGFHEGDVITLTNQIAKNRYEGLLSPLSYVEVLVPLPQ
Download sequence
Identical sequences ENSCPOP00000019516 ENSCPOP00000019516 10141.ENSCPOP00000019516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]