SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000021054 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000021054
Domain Number 1 Region: 882-1077
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000378
Further Details:      
 
Domain Number 2 Region: 25-64,95-162
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-20
Family PDZ domain 0.021
Further Details:      
 
Domain Number 3 Region: 695-798
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-17
Family Pleckstrin-homology domain (PH domain) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000021054   Gene: ENSCPOG00000025821   Transcript: ENSCPOT00000028015
Sequence length 1404
Comment pep:known_by_projection scaffold:cavPor3:scaffold_53:9612060:9645288:1 gene:ENSCPOG00000025821 transcript:ENSCPOT00000028015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPAVLCLGEPGVPATCRSPCLPVSPQLPLGPKDGCSPGRPLHWQGPRTLLLRKSLQDGF
GFTLRHFIVYPPESAVHCNLKRVFNLGRGVGASPRHRLEPMDTIFVKSVRDGGPAHRAGL
RTGDRLVKVNGESVIGKTYSQVIALIQDSDDTLELSIMPKDEDILQLAYSQDAYLKGNEP
YSGEARSIPEPPRLCYPRKTYALPARLSAWATMVPEPASALPSDPRSPAAWSDPGPRVPP
ATRTPSEPSSGMSQPRPSPGAFLHLPSEPRTPQAFPEPSGRVLPSRLECQQALSHWLSKQ
VPRRAGESRCPAMPPRTRSASQDRLEDVTAHRVWPCSTSQDALSQLGQESWHQARSEDYL
GRATRSAEALGPGALGSPRFERCGWASQRPTARTVTCPARDLPGPQAPPVPGLQGLDDTG
YVGYRSYSPSFQRRTGLLHALSFRDSPFGGLPTFSLAQTPTPFPPEASEPPKVSKPEPST
RALEPPTDDHREEVVLRQKPPTGRKGPPGPTRQMNLGFGEETLEPEAGGRGERPGRRVAP
LATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPTSPTFTFALSR
HYSQDCSSIRAGRRSSYLLAVTTERSKSCDDGLNSFRDEGRALRRLPSRVPSLRVLRSFF
TDGSLDSWGTSEDADAPSKRHSTSDLSDTAFSDIRREGWLSYKQVLTKKGKKAGGGLRQW
KRVYATLRARSLCLSKAGEGEGGRPPSCIAPCLVDISYSDTKRNHRLTFCENLFQAEDRD
DMLGWIRAIRESRAEGEDPGCANQALISKKLNNYRKVSHGSGPKAEASPKVSLKPEFLRQ
SAARALRTQEQPAGSKDDSAAAPKTPWGINIIKKNKKAAPRAFGVRLEECQPATENQHVP
LIVATCCRIVEARGLESTGIYRVPGNNAVVCSLQEQLNRGLGDINPQDERWQDLNVISSL
LKSFFRKLPEPLFTNDKYNDFIEANRIEDARERMKTLRKLIRDLPGHYYETLKFLVGHLK
TIADHSEQNKMEPRNLALVFGPTLVRTSEDNMTDMVTHMPDRYKIVETLIQHSDWFFSDD
QDKGERTPVDDKEPQAVPNIEYLLPNIGRTGPPGDSGSDFTTCNSAKSKAPWAPRKEPCT
REMLAISFISAVNRKRKKRREARGLGSSTDDDSEHEAAQAGVPGGPDPADGSPTTLAPDA
RYVVSGYSTLGTRRAGAGDEADDERSEPSLAGTDTEGAGAGPSFSSHRLMAGDTLARRRL
SRGRANPEDDRAPAPGSASSSSQESPSRLETLRLRLRGTADDMAVRLRRPLSPETRRRRS
SWRRHTVVVQSPLTDLNFNEWKEAGAQDTTGARAHSDNKDSGLSSLESTKARASSSAASL
PPDLGTLQGVAPRLASTSHLHPCL
Download sequence
Identical sequences ENSCPOP00000021054 10141.ENSCPOP00000021054 ENSCPOP00000021054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]