SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|161702940|ref|NP_926784.2| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161702940|ref|NP_926784.2|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 1.35e-22
Family Ribosomal protein L28 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161702940|ref|NP_926784.2|
Sequence length 81
Comment 50S ribosomal protein L28 [Gloeobacter violaceus PCC 7421]
Sequence
MSRKCMLTGKKANNAYSVSFSHRRNKRLQMANLQWKRIWDDQQGCFVRLKLSTKAIKTLE
HRSLHALAKEAGLDLSKYVVK
Download sequence
Identical sequences Q7NEP1
gi|161702940|ref|NP_926784.2| 251221.gvip514 NP_926784.2.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]