SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519606|ref|NP_922983.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519606|ref|NP_922983.1|
Domain Number 1 Region: 118-191
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000129
Family Carboxypeptidase regulatory domain 0.024
Further Details:      
 
Domain Number 2 Region: 37-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000994
Family Type I dockerin domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37519606|ref|NP_922983.1|
Sequence length 398
Comment hypothetical protein gll0037 [Gloeobacter violaceus PCC 7421]
Sequence
MGCAPSLKPGRELTMFRILLLIALLALPPGAALAAEAGDIDGDGRVDAGDIQAIDAYLEG
AVVLQDSQIASADADGDGKITRRDRDLLKRRVDGVALKGEARVGDGGGGKIDLTSADSGV
VTDKETGRPLAGVDVSLPDEGITVRTDSEGRFKLPKATGGKILTAKANNYAPFSLSAATG
SPGGGFNLELERLSPRLQVIDDELHHLGDDRFGSGSANATDFRLRAEGIAYVRTFTLKNQ
PTGDMILRIGSVIGLDTPQSAAAGQTQVAFFGTEQDGLRVYLNGNMIKQIYINGDNIPVK
LPRWLLNSGKNELRIETHAFNQPAFMSAGGLAGLLGAFGIGGMGMMAGAGIVDHDDLEFA
HLVLEDSAGRPQEFSSRGRVYGGETPRGGEVYTPQVRP
Download sequence
Identical sequences Q7NPL8
gi|37519606|ref|NP_922983.1| NP_922983.1.44878 251221.gll0037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]