SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519627|ref|NP_923004.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519627|ref|NP_923004.1|
Domain Number 1 Region: 104-162
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000000602
Family Carboxypeptidase regulatory domain 0.044
Further Details:      
 
Domain Number 2 Region: 28-86
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000206
Family Type I dockerin domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37519627|ref|NP_923004.1|
Sequence length 364
Comment hypothetical protein glr0058 [Gloeobacter violaceus PCC 7421]
Sequence
MRVRHRSQVLFITAASLLLLAQSLPAASGDVNSDGRVDDLDIRIVEQYLRGDLLLQNDQI
KAADADGDGKVTRNDRDLLKRRLEGITVKSGPASQLELQSVSGGVVLDKATGKPLAGVEV
SLPDEGITVRTDAQGRFKLARAPAGKILTAKASSYAPQSITLARGGSGGYRLLLEQLNPQ
LMVVDDNLYHLGNDDFDPNSAGALQFNLRSIGGRFEKTFELTSFPREDLTLRIGSLIGLD
TPESVAAGQSGLTDRILPRGGLRIFLNGSAIERLVLNGDDLEVKLPRWLLQRGTNRLMLS
VDPYDQNNISISKPVTGLYGTATRSSFDLDDIEFAHLVIVDPTGSLVDGKLEGELGKKPS
PPGP
Download sequence
Identical sequences Q7NPJ7
251221.glr0058 gi|37519627|ref|NP_923004.1| NP_923004.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]