SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519628|ref|NP_923005.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519628|ref|NP_923005.1|
Domain Number 1 Region: 24-81
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000109
Family Type I dockerin domain 0.0024
Further Details:      
 
Domain Number 2 Region: 106-167
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000000327
Family Carboxypeptidase regulatory domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37519628|ref|NP_923005.1|
Sequence length 363
Comment hypothetical protein glr0059 [Gloeobacter violaceus PCC 7421]
Sequence
MRRIVFLFVCLGVWTAGAAARAASGDVNGDGRVDAGDIRLIDEYLGGTRLLQDEQIKAAD
ADGDGQITATDREMLDRRVSGLAAGSAAPGRSASRGQVDLTSADGGVVVDKATGRPLAGV
EVSLPDEKITVRTDAQGRFRLPGTASGKILSARAENYVPSSVTTRGQRGFQLQLERLNPR
VQVLDDELVHLGDNNYDRRSAGARQFQAPAAGTRYTRTFALGRLPGQDLQLRIGSLIGID
TEESIAAGQSNLPAAGRREQRAGGVKVRLNGRIIGELLLGGDDIAIALPRQLLRPGANEI
ALEAALINRSGVVIEPDSFLGKMRGLGLGDMALSPDSLDYDDIEFTHLVIVDPSGKALER
REP
Download sequence
Identical sequences Q7NPJ6
NP_923005.1.44878 gi|37519628|ref|NP_923005.1| 251221.glr0059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]