SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519629|ref|NP_923006.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519629|ref|NP_923006.1|
Domain Number 1 Region: 20-79
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000288
Family Type I dockerin domain 0.0022
Further Details:      
 
Domain Number 2 Region: 116-174
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000798
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37519629|ref|NP_923006.1|
Sequence length 377
Comment hypothetical protein glr0060 [Gloeobacter violaceus PCC 7421]
Sequence
MIRVLCLVGLALLAAAPAWAESGDVNGDGRVDAGDIRLIDEYLEGSLLLQDEQIKAADAD
GDGKITATDREMLDRRLSGLAVAPAPAGRSASAAKNQRTAPPDTSGASIDLNSADSGVVV
DKTTGRPLAGVEVSLPDEGVTVRTDSQGRFQLPKSSAGKILTAKASNYAPTAMASRGGGG
FQLKLERLSPRLQVVDDGLVHLGDNSFGPGSANYAEFRQPAQGRSYTKTFALDRLPQRDM
ILRIGSLIGLDTPESVAAGQSQLPLYGTSSDGLRVYLNGSLIKQIFVNGDNLPVTIPRWL
LVRGNNELRLETHPVGGNRGGAVMSSRGFGGMLGGLFGFGGSMRFPVDSTPDYDDIEFAH
LVLEDPSSNERPSRVEF
Download sequence
Identical sequences Q7NPJ5
251221.glr0060 NP_923006.1.44878 gi|37519629|ref|NP_923006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]