SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519765|ref|NP_923142.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37519765|ref|NP_923142.1|
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0267
Family SinR domain-like 0.045
Further Details:      
 
Domain Number - Region: 77-119
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 0.0288
Family AbrB N-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37519765|ref|NP_923142.1|
Sequence length 129
Comment hypothetical protein glr0196 [Gloeobacter violaceus PCC 7421]
Sequence
MAPLQGRDLLKLIKENQGKSAKQLAELAGYTTTTKSGQKRVKMLAFQSAILQANNISLIP
RHEEGEGVRGGRKASYRIQVQQNGNLLIGTAYTRQMGLEPGTEFEIQIGRKHIKLVQLDS
PDSPQTNED
Download sequence
Identical sequences Q7NP61
gi|37519765|ref|NP_923142.1| NP_923142.1.44878 251221.glr0196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]