SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519774|ref|NP_923151.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519774|ref|NP_923151.1|
Domain Number 1 Region: 104-198
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000000973
Family Intein (protein splicing domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37519774|ref|NP_923151.1|
Sequence length 200
Comment hypothetical protein gll0205 [Gloeobacter violaceus PCC 7421]
Sequence
MVKVAGVNLTASSSFKVNASMAPLSAHLDLVGVLGALQLLADVGGLIPDLNVPSALLGVG
VAAALGDAAGVLTSGFALVPFGGFAKAGIGLRNGIVAASRAYGCFGEGTAVQTETRAKPI
EQIEPGEKVLARSERTGQQSLRRVKSTFQTGEQTLRRVKSTFQFDSQPVYRLQSRETGGN
GERDTSTVTGEHPFYLQGQG
Download sequence
Identical sequences Q7NP52
NP_923151.1.44878 gi|37519774|ref|NP_923151.1| 251221.gll0205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]