SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519782|ref|NP_923159.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519782|ref|NP_923159.1|
Domain Number 1 Region: 1739-1879
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.63e-22
Family Intein (protein splicing domain) 0.02
Further Details:      
 
Domain Number 2 Region: 1482-1554
Classification Level Classification E-value
Superfamily E set domains 0.000000000000764
Family E-set domains of sugar-utilizing enzymes 0.02
Further Details:      
 
Domain Number 3 Region: 1316-1397
Classification Level Classification E-value
Superfamily E set domains 0.0000000000191
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 
Domain Number 4 Region: 1400-1479
Classification Level Classification E-value
Superfamily E set domains 0.000000000331
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 
Domain Number 5 Region: 1578-1647
Classification Level Classification E-value
Superfamily E set domains 0.00000154
Family E-set domains of sugar-utilizing enzymes 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37519782|ref|NP_923159.1|
Sequence length 1973
Comment hypothetical protein gll0213 [Gloeobacter violaceus PCC 7421]
Sequence
MHLRTLSKTYLAFLWWFLMRNAFLSRWRAALRRAVCLLVLFVYCGGFALQAASASVDVVS
GHYAYDTVDLVLGGRYPLMLQRHYQSSEQDRTPLTSYPGPFGPGTHMGLYSLRAAPVLDV
AGQITKVRLSLPTGGAQLFATGVSGAPAGSYGNANPSDPIRGSFTVSGNATSSTLVLTLE
SGLVLSFSATLSGTRQLNSLTDRFGKAITFSYSGNNLTRVQDPFGRRIDFTYDATFTHQV
RTATLYDNQGAVGGSVLYEYNSAGDLQYFHNAMDGQSVNNPDGTTRTVNGLTTYEYQNHY
LTKITDPRGTVRLTNSYENFNTSGQAGRVTLQTLPGMDGRPGANGDQYTADDVLAQYVYS
TGSTAVNDALYKTSDKQNWDKVTYNFDASTQQITAFSYAIDAAATYGFEYDPSTRDLTRF
TNAYGQQTRFDYDGSYFRHLSGIELADSGRTSYSFTAPFGQIDSVTTPNNQSTYYEYNDP
AGSYENSGYKGSLKSIADQLPENTSFEAYNPYGQATRVVDGQGRTTEFEYFDYPNNYITP
GTANQDPHYITDPSGVQTCFRYDTLSRLKAVFYCYQFEQTNRWTEYSYDTLNRLIKITSP
SDASNTRRITEFTYDDNSNVTSVKAPNGVLTTYTYDPMDRVATRAQAGRTEYFSYNNLGL
LSKYKNARGQETLYEYGSKQRLRYVTFADGTKLTYSYNTLDQVASITDSSDASGARNVYF
EYFTGTDQVSRLKTERIGTGETVRYFYDASGNLTSIKKGTSDASATPLINYDYKDDDASL
ATAGLCGNSTCDQNNAVVGFEYDPDGSLKSINYPNSIKEELFYNDGGEVERALFSGPGGT
LLREIAYQYDYSTRGYLTSRTESGPSTPSVATSQSYSYNETGELTGATTPAGNYTNAYDK
DGNLTSSSRPGASTTPSYEAGTNRMTAFEGGTLIYDGSGNLVEQNVGSTKVTFTYNARNQ
LSSYTNNAGFTVSFVYDALGRRMGKTISGTTTSYLLSGNQVIEQKTGSTTRRYLVGLGLD
EVFMSREGSTDEYLLHDPLNNSVVAAVNGSTQAIKTGYGYSPFGQVTASNTSSNNLWLFA
GAEAVNSASVVYHMRSRYYHAGNQRFMAEDPIGFAGGDTNLYRYLGNAPVTTSDPTGLRP
DVRPRGVATLPGLSISTPEAPRATGAAESISKERATLSPSTISRPVERLAQSAQTKSVKL
GQPGSRTDTAPGQDTLDCTPLPLTVVAGQSLGNICGYFEGPNSDLVDGSVRVSPSASGLS
ASISPDPVYVYSTFTVRVQTSTATPPGVYTLTADGYSVYDGTYYQPDSVTFEVLPPAPQI
NSISPGRGVTGSTVTLSGANLNYAPTVQFDNRLTATITSTSASEIKAIVPSGLPSYYGVP
VNVTTKSGTSNNATFTVIVPPSISSFSPSSGKAGDNIAVTGADFYNLYGAAFNGTAASIL
SVSSSGTQMNLSVPSGASSGPISVSTEAGTATSPSSFTVNAPPSVSSLSPTAGAVGASVT
VNGSNFTGASSVKFNATAAGFSVVSASQISATVPTGATDGAVSVTTAGGTASGGFFDVQA
TPTINSSGGVVGNPGSGVLSASASDTVLINGTNLNTLNSVTINGIAAYAVAVSATQIQVS
LPENATTGPLVVQAAGVNLTASSSFKVNASTAPPSAHLDLVGVLGALQLLADVGGLIPGL
NVPSAVLGIGASIVLGDAASAAGFGLTFLPFGGFAKAGVGLFKARTGLRNGIVAASRACG
CFAEGTEVQTETGTKAIEKVEPGEKVLARNEKTGEQNLRRVQSTFQFDDRPVYRLELRET
GGQGERDTLTVTGEHPFFLKDKGWTAAERLRSGERVQAVDGKWLRVVGLQPQQQRARTYN
LEVEGEHTFFVGDTRAWVHNECLPTGLASQYLDVTRRKTTTRNIRTDVSVDEFRENLLDN
GFAELPAIEALKGDILRFSKGATEYYLRSFSKSGPPTAELLVNGEQVLKLRLK
Download sequence
Identical sequences Q7NP45
NP_923159.1.44878 gi|37519782|ref|NP_923159.1| 251221.gll0213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]