SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519815|ref|NP_923192.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519815|ref|NP_923192.1|
Domain Number 1 Region: 49-475
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.73e-104
Family Glycine dehydrogenase subunits (GDC-P) 0.00000117
Further Details:      
 
Domain Number 2 Region: 515-923,966-988
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.39e-98
Family Glycine dehydrogenase subunits (GDC-P) 0.000000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37519815|ref|NP_923192.1|
Sequence length 998
Comment glycine dehydrogenase [Gloeobacter violaceus PCC 7421]
Sequence
MSEPTIDRELDLHTFWQDASEPAPDTTIPAVALANGKGHLDYTDRFAGRHIGPDGREVER
MLSTLGFESLDALIERAVPAQIRMERPLRLPKGLSEYEVLARLRAIAAQNRVFRSFIGMG
YAECITPLVIQRNILENPGWYTQYTPYQAEIAQGRLEALLNFQTMVIDLTGLEIANASLL
DEGTAAAEAMAMSFGIKAKGRAKRFFVSEHCHPQTIAIVQTRALPLGIDVIVGDHRAFDF
QVQPCFGALVQYPATDGALFDYRAFVEAAHRAGALVTVAADLLSLALLVPPGEFGADIAV
GNTQRFGVPMGYGGPHAAYFATRDAYKRQIPGRIVGVSTDAHGQRALRLALQTREQHIRR
DKATSNICTAQVLLAVMAGMYAVYHGPVGLRRIAARIHRLTRTLAAGLVRLGHLLGSAPY
FDTLRVELNGIDTRTIVERAEARRLNLRVLDERTIGVSLDEATSTRDLEDLLAIFALEGE
PDFTIAELAAEVSQVQAPEVFGRQSAYLTHPVFNRYHSETELLRYMRRLESRDLSLTTSM
IPLGSCTMKLNATAEMLPVSWPEFAKLHPFVPLSQARGYQILFEQLEAALAEITGFTAVS
LQPNAGSQGEYSGLLVIRAYHHSRGEAHRDVCLIPQSAHGTNPASAVMAGMQVVPVACDE
QGNIDVADLEAKATTHAARLAALMVTYPSTHGVFEEAIVRICAIVHGRGGQVYMDGANLN
AQVGLCRPGDFGADVCHLNLHKTFCIPHGGGGPGMGPIGVASHLAAFLPRHPVVSQVGGQ
AGIGAVAAAPWGSASILTISWVYIFLMGGPGLTEATKVAILNANYIAHRLAPHYPVLYKG
AGGLVAHECILDLRKLKTTAGIEVDDVAKRLMDYGFHAPTVSWPVAGTIMIEPTESESLE
ELDRFCEALIAIRHEIAAIERGEADRADNPLKNAPHTAAVLLADSWEHPYSRAQAAYPAP
WLYQHKFWPVVSRIDNVYGDRNLICSCLPMEAYAQDGK
Download sequence
Identical sequences Q7NP12
gi|37519815|ref|NP_923192.1| 251221.glr0246 NP_923192.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]