SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519943|ref|NP_923320.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519943|ref|NP_923320.1|
Domain Number 1 Region: 21-212,313-401
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.4e-86
Family Bacterial dinuclear zinc exopeptidases 0.0000181
Further Details:      
 
Domain Number 2 Region: 200-311
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.4e-31
Family Bacterial exopeptidase dimerisation domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37519943|ref|NP_923320.1|
Sequence length 407
Comment N-acyl-L-amino acid amidohydrolase [Gloeobacter violaceus PCC 7421]
Sequence
MLLRRPRRTVMSDTPRPRPSIGALQPQLVQWRRHLHRFPELGFQEQATSRFIAQKLASWG
IDVQTGVAKTGVVATIAGRGDGPVVAVRADMDALPILEGNRVEYASENTGIMHACGHDGH
VAIALGTARWLAEHRDALPATVKILFQPAEEGPGGAKPMIEAGALASPDVAAIVGLHLWN
NMPLGQVGVKGGPSFANAAKFKATILGRGGHGAIPQQTVDAVVVGAQVVNALQTIVARNV
DPFEPAVVTVGKFQSGTNFNVIAQSAYLEGTVRCFSPELETRLPERIEQVIAGICQAHGA
SYEFEYDRHYPVLMNDPAVAELVRSVAEEFLGRGRVRPETTLGGEDMAFFLQKVPGCYFF
LGSANPERGLDKPHHHPCFDFDETALGLGVELFVRCLERFWERSMAE
Download sequence
Identical sequences Q7NNN7
251221.glr0374 gi|37519943|ref|NP_923320.1| NP_923320.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]