SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37519973|ref|NP_923350.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37519973|ref|NP_923350.1|
Domain Number 1 Region: 22-320
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.73e-37
Family Pectin methylesterase 0.038
Further Details:      
 
Domain Number 2 Region: 603-635
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.0000745
Family Sporulation related repeat 0.015
Further Details:      
 
Weak hits

Sequence:  gi|37519973|ref|NP_923350.1|
Domain Number - Region: 376-409
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.000628
Family Sporulation related repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37519973|ref|NP_923350.1|
Sequence length 640
Comment hypothetical protein glr0404 [Gloeobacter violaceus PCC 7421]
Sequence
MTMKFSDTVVRRLVGWTLALSLLGTASASVVQAQADLERDLSMTYVDAVNGDDSTADGSK
QKPFKTITRAILGSPPGVTLQLAEGEYSEATGEQFPIQLAMRNLVGNEATKGQGIKIVGG
GKHVSPTFASQDATIVVGKEVTIRGVTITNPRNRGKGLWIESVSPVIAHNSFIGSLHDGI
FITGASSAKVADNYFSGNIADGLTAADQSTPLIENNIFEKTGFAINVTGRSRPQIVGNTV
RDNVDGIVIEGRSFPKLRNNTITGNRRSGVVVVLLASADMGTESEAGNNTFGGNGRADIN
NVTRPALPLVALGNKWDKPRLEGQVTAEAEIVALATRNVAPNVGFWVLVSNGKPAQLRAI
KGLALKPKSQTHEGKPYQQVGTFGSQASADKLVEQLSKKGFNAIAVPAGQPTGSNLATSK
PTKPTISQAPAKPPAAAATAAKPASAPQVTAKPVAPAVVAVKASPTTPPETPITKPGPLS
PGAPAVKASPATPEAPVAAQVSPLPPIAPKASPVSATPVPAATTPAASATALASPVLRAP
AAKPAADTAAAAGPTTATPGETVAAKPATGLAYRVLVTDSGSADLDLLKELVARVIQQMY
EGKPVLQVGVFSSEDNANRLVQTLSDKGFRAILVPVNQPG
Download sequence
Identical sequences Q7NNK7
gi|37519973|ref|NP_923350.1| 251221.glr0404 NP_923350.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]