SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37520077|ref|NP_923454.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37520077|ref|NP_923454.1|
Domain Number - Region: 106-191
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.00194
Family BC ATP-binding domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37520077|ref|NP_923454.1|
Sequence length 256
Comment hypothetical protein gll0508 [Gloeobacter violaceus PCC 7421]
Sequence
MIPPLWVAGPAELTGALAQSCRRWGGEVRVLESSSLQALDPAGRIIWLARPDSTSPATAL
FERCADLAPTEVPLALPDSTASLLVLPLVITARGVLYAEAIGMAGEYLWQPEPLSDKARQ
ILYRFARGLIDLSEPLPPGVYMVYFTVICGAVRFEKLIPHPDRTALVTLTSQRPDLFCCH
WRCALGLPVVDLQVHRPTAAAFVGDWPDDLPLRAALEPEASLDAAAGLVLVQAPTLQQAR
SKVQTLLGETDADAGR
Download sequence
Identical sequences Q7NNA3
251221.gll0508 gi|37520077|ref|NP_923454.1| NP_923454.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]