SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37520079|ref|NP_923456.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520079|ref|NP_923456.1|
Domain Number 1 Region: 331-524
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.31e-52
Family Ppx associated domain 0.0016
Further Details:      
 
Domain Number 2 Region: 139-315
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.03e-44
Family Ppx/GppA phosphatase 0.00067
Further Details:      
 
Domain Number 3 Region: 12-134
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.68e-36
Family Ppx/GppA phosphatase 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37520079|ref|NP_923456.1|
Sequence length 554
Comment exopolyphosphatase [Gloeobacter violaceus PCC 7421]
Sequence
MPEPAADAEKTLAAIDIGTNSIHMVVVHIQPRLASYTIVAREKQMVRLGEYCQKTGWLTP
EAMVRALDALRHCKAFAEGLGAQEMIAVATSAVREAPNGPEFLLQIQRVVGLKVDLISGE
EEARRIYLGVLSAIEFDNRTHAVIDIGGGSTELILGDGREPRYLASVKAGAVRLSEQFVQ
SDPISGRDYGRLRNQVRNLIEPAVDKLLALGPFERLVGTSGTIMTLAEIDARRGGSFPTS
LQGYELTLASLEQIAAQLRELDLEARRRLPGVSERRADIIVAGATILLEAMQMLGVGSIT
VCEAALREGLIVDWMIGRGLIADRLRYQGSVRERSVLQLADKFNLDTTHAEQVTRLSLSL
FDQSRGRLHRWSDADRELLWAAAMLHNCGHFINHSSHHKHSYYLIRHGGMLGFTEEEIEV
IANVARYHRKSTPKSKHREFQHLVKEHKRLVRQMSVFLRLASALDRRHKGAVRGVRLAFA
PGEVELFVQPHDPADPCEMELWNAEFKKAEFEQEFGRTLAIALESAVAEPLAVLGAKAET
QPDAVRVPQGSWVS
Download sequence
Identical sequences Q7NNA1
NP_923456.1.44878 gi|37520079|ref|NP_923456.1| 251221.gvip052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]