SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37520224|ref|NP_923601.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37520224|ref|NP_923601.1|
Domain Number - Region: 456-555
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00124
Family TonB 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520224|ref|NP_923601.1|
Sequence length 596
Comment hypothetical protein glr0655 [Gloeobacter violaceus PCC 7421]
Sequence
MTFAVPNFLLIAAAVAPALFLLALLALLPKSVTRWAAPRPLWTVAIATLTGVGSAFIALP
VEMLLTSTPWRITNLGVLAVFALVAAGLAEEGAKYLVVRFYSWRLAPFRERYDGLLYGGA
VGLGFGALENVFYVSEGGLETAMVRALTAVPFHGMLGLVMGYFLGRAKVRQLAGERWGGL
HALGLFWAVLLHGLYDFFAFQASQIALVLLNGLLVVMALWCLRTVISTRALSPSWGGCEP
AAPTPFVPPPAVARNPMLAGILGLVPGLGQFYNREWQKGLFLLAAGIINLVLLASVWLLL
NAPQAAIEALFVLAGLSLAIKPEQFIQTLAAAPVLQILLALNAVFCLLSAFDAYRTARSG
RFDYLKAPEKRIRFLQTFSASYVGHVLLLFFAVLVPVIAGGGPKGQGEQPGQIGTIEFDL
VTTPKKLDGFSGKPEGTAKGTAKKNAPKVVAQKSAPVPVPGPQAPKAQEAQEAKGLPRSY
NEYLSWKIRRYHDLYFDRVGTGQYTVVQYEIDSVGNVTNVQVLYDHTTAPGDVAEMAAET
VRRLDPALPLPKGIRSVTITELFWDGSPIGSPGSLEQHLSELPDGREVMPYPPEQS
Download sequence
Identical sequences Q7NMW0
251221.glr0655 NP_923601.1.44878 gi|37520224|ref|NP_923601.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]