SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37520276|ref|NP_923653.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520276|ref|NP_923653.1|
Domain Number 1 Region: 40-138
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00000000000249
Family TonB 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520276|ref|NP_923653.1|
Sequence length 282
Comment hypothetical protein glr0707 [Gloeobacter violaceus PCC 7421]
Sequence
MVGDTLEQLLPHWMLSMVRLLFCSMLALSLAGPLAPPLLAQEPKAASNPELKAYQVKVRD
RVLEYWQPPDIDSDTRLQVLVRVDRDGKVSKREVKTLGDAPPSKAAEEAVLDAIGRAQPF
PTVPPNVAPFYVEVRFNLKVAAKTLPTPRCYPVATFIDLPAEQQPAVKSAITNLTGLLRD
SVGEKEIFSIVDDRAKADLLIEASSDPTMARNDKTSFIGSYTVNEALTTGTARLGLKIER
AQISVLSNSASMRCSCWAAVWAYPAREALPIRSCRRRGWRRG
Download sequence
Identical sequences Q7NMQ8
NP_923653.1.44878 gi|37520276|ref|NP_923653.1| 251221.glr0707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]