SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37520357|ref|NP_923734.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520357|ref|NP_923734.1|
Domain Number 1 Region: 14-188
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.28e-28
Family HD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520357|ref|NP_923734.1|
Sequence length 199
Comment hypothetical protein gll0788 [Gloeobacter violaceus PCC 7421]
Sequence
MQTPALEVSWRVSVLEWLARHVPPKRIEHILGVESTAVALAERYGASPERAGRAGLLHDL
AKYFPPEKLLLEADRLGIAVDGIQRRTPHLLHADVSAGLAREIFGEADPQVLMAIANHTL
GDAEMDLLSQILYVADWIEPTRKGEDVARVRQAAQANLMEAVLLGAEQTILDLIESRRAV
HPRTLLTRNWALSTLEEHL
Download sequence
Identical sequences Q7NMH8
NP_923734.1.44878 gi|37520357|ref|NP_923734.1| 251221.gll0788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]