SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37520512|ref|NP_923889.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520512|ref|NP_923889.1|
Domain Number 1 Region: 9-310,419-451
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.37e-51
Family FAD-linked reductases, N-terminal domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 294-402
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.06e-29
Family L-aminoacid/polyamine oxidase 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520512|ref|NP_923889.1|
Sequence length 466
Comment protoporphyrinogen oxidase [Gloeobacter violaceus PCC 7421]
Sequence
MNTAEELLDVLVVGAGLSGLALAWKLKRAGCTFLVCQAGERVGGAITTAIADGFVCEGGP
NSFQESPPLIELLTQLQLEDQIVTADPRLARFVWWENRLRSVPLTPAQLVRSDLLSWSGK
ARLLWELFVPALGEPREETVAEFVLRRFGEEVLSRLVDPLVSGMCAGDVGQLSIEATFER
LVDLERRHGGVLRGLWRTARTRPPFKRLCTLRGGLEQLPQALAQRLQPQILLSHRLEALE
HLAGDRWRAVVAGPQGEPVAIAARTVILSGSAHAMASVLRPLDAGLGRALESIYYPPVVS
ISLAYSKSQVPNAPEGFGHLIPRNQTLRSLGVIWNSSLFPHTAPPNWRLYTCFVGGTTDP
ATPNLSDTELASLAHRELQTVLGFQAGYQLLRVTRWPQAIPQYALGHPSKQERVERALLG
LPGLFLVGNYFGGISLGDCVRHSGAVASRVLQFLTTVASNGSLRPA
Download sequence
Identical sequences Q7NM26
gi|37520512|ref|NP_923889.1| NP_923889.1.44878 251221.gvip126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]