SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37520589|ref|NP_923966.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520589|ref|NP_923966.1|
Domain Number 1 Region: 1-572,599-606
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 3.79e-149
Family Prokaryotic type I DNA topoisomerase 0.0000000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37520589|ref|NP_923966.1|
Sequence length 653
Comment DNA topoisomerase I [Gloeobacter violaceus PCC 7421]
Sequence
MMRLLICESPGKIKTFKAILGAGWDVQASLGHVMELANDGADHLGFDVGPEAITCRYVPR
GERGMATLKKLRTAAAKAQEVYLATDPDREGEAIAWHLARELRLKSPRRIRCTQITEGAV
RTALQSPGRLDMDLVSAQRARQCLDKLVGYKVSPLLWNATGGKSAGRVQSATLHFVCERE
REIIAFVPVDYWSVWVEYAPGWRAYYQGDVQETPESTEATDDAKSNKEAPPAESTRVLSE
AEADRLVALARSHPHAVERVERRTVTKIPPAPFTTSTLQQAAGALLSYNPERTMGIAQQL
YEGIDLPTGRKGLITYMRTDSVEVAPEFVEQARTYLQINDPDNLPARSATHRSRAGAQQA
HEAIRPTDVSLTPRTIRAHLSEEQLRLYDIVWRRAVASQCAPARLAKTKILTRSGPVHWQ
ALGMTVAFAGYTRYWNDLEAALALPALEAGQNLELLRSAHEKKRTQPPPRYSEPKLVQLM
ERKGVGRPSTYASTIKTLKERAYVELQGRALVPTELGLATDALLGRTLPELVDSAFTARM
ETGLDAIAASREPWEKYLIGWNTDYLVPAVARARAAIAAEFPKRPAAPRTAQAPQISRTP
CPRCRQALSKVPSKKVKRGYFLKCPACADLVMFWNPWRKIWELPKPKTDPQTP
Download sequence
Identical sequences Q7NLU9
251221.gvip136 NP_923966.1.44878 gi|37520589|ref|NP_923966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]