SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37520663|ref|NP_924040.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37520663|ref|NP_924040.1|
Domain Number 1 Region: 12-319
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-67
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000393
Further Details:      
 
Domain Number 2 Region: 334-473
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.78e-39
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37520663|ref|NP_924040.1|
Sequence length 481
Comment 2-oxoisovalerate dehydrogenase E1 component subunits alpha and beta [Gloeobacter violaceus PCC 7421]
Sequence
MRISDQSLTIPLKELLNLMLIVREGDLREGNLMRQGKGWIHIPGMGHESLIAITHHLHRE
DYLFTYYRDRALMLGKGFTAQQLAWDYFACAKSSTGGRGMPVHCSAKHLNIFPPATPTAS
QCLPAVGAAWGIKHSEKTDVVICTIGDASVRQGEFYEAVCMAVQERLPVIFVVEDNAYGI
STSTKHQLPFRLGIFNEEIFVRVDGRHPAEIFNHSGQAITKARQGNGPTILWVELDRLVS
HTNSDDHRIYRPKEEIDAMLQRDPLSVLARHLINAGELTATEWQALQFKTAMTIDEIYQQ
AERENSPNPDQILVHLYGSKVDHQCVPFQPVERTTTMVAAINQTLREALQLYPQMIMFGQ
DIEDPKGGVFGFTKGLSSQFSQRVTNSPLAEATIVGVAAGLAATGYKPVFELQFIDFITP
AFNQLVQQIATLRWRSQGDWSCPMVLYAPYGAYLPGGSTWHSQSNEGWWTHIPAEVLNVR
N
Download sequence
Identical sequences Q7NLM8
gi|37520663|ref|NP_924040.1| NP_924040.1.44878 251221.gll1094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]