SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521098|ref|NP_924475.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521098|ref|NP_924475.1|
Domain Number 1 Region: 9-332
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.72e-104
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521098|ref|NP_924475.1|
Sequence length 334
Comment pyruvate dehydrogenase E1 component alpha [Gloeobacter violaceus PCC 7421]
Sequence
MTMVQQQLPPTRYHIDRPEALVLYRDMVLGRTFEDTCAQMYYRGKMFGFVHLYNGQEAVS
TGVIKAMRPDDYVTSTYRDHVHALSKGVPARSVMAELFGKATGCSKGRGGSMHLFSAEHN
LLGGFAFVAEGIPIATGAGFTAVYKGTDQVSACFFGDGATNNGQFFECLNMAALWNLPVL
YVVENNLWSIGMYHHRASSVIEIYKKADAFGIPGVRVDGMDVLAVRAVAKEAIERARAGG
GPTLIECTTYRFRGHSLADPDELRDPAEKEFWRKQDPIPRLAAFVREQELASAEELKAID
QEIRAEIDDAVLFAEESPEPPIDELYRFQFAEDA
Download sequence
Identical sequences Q7NKE9
gi|37521098|ref|NP_924475.1| 251221.glr1529 NP_924475.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]