SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521128|ref|NP_924505.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521128|ref|NP_924505.1|
Domain Number 1 Region: 82-344
Classification Level Classification E-value
Superfamily Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 3.14e-47
Family Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 0.00056
Further Details:      
 
Domain Number 2 Region: 9-75
Classification Level Classification E-value
Superfamily Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain 4.45e-16
Family Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521128|ref|NP_924505.1|
Sequence length 345
Comment hypothetical protein glr1559 [Gloeobacter violaceus PCC 7421]
Sequence
MSTAFREFVKKIGSGRLTGRDLTREESCRAMAMLLHQEATPTQIGAFLIAHRIKRPTPEE
LAGILDAFDQVARPLTVPADAPPPLVLSSPYDGQDRLANVTPLAALIVSALGQGVVLHGS
TDMPPKHGLTSFDLLAGLGVDLKRDRQILSEQYRATGLGWVYLPAHFPEAFALQAFRDEI
GKRPPVATAELFWNPVGVGLPVIGYTHRETITLAVQTAPLRGATAMVMVRGLQGSVNCTL
FHPNLGVRWTAAMDTPEPFRILASDHGLGDDDLSLVGDGQDLERQSGLCLETLQGKDTPL
RRATIFNSAFLLVQSGHSASLETAIPLAARALDEGLAWRQLEKLR
Download sequence
Identical sequences Q7NKB9
NP_924505.1.44878 gi|37521128|ref|NP_924505.1| 251221.glr1559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]