SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521215|ref|NP_924592.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521215|ref|NP_924592.1|
Domain Number 1 Region: 338-492
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000000188
Family HD domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|37521215|ref|NP_924592.1|
Domain Number - Region: 598-697
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00051
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521215|ref|NP_924592.1|
Sequence length 724
Comment glycyl-tRNA synthetase subunit beta [Gloeobacter violaceus PCC 7421]
Sequence
MATFLLEIGTEELPASFVPGALAQLEARVRSALAEAQITAETLKLFGTPRRLAVLAEGLP
ERQPDREEELKGPPARVAFDAGGRPTAQAEGFARKAGVAVGELSVRATEKGEVVFAVRRI
EGRPVTQLLAEQIPEWITGLEGPRLMRWADGDLRFSRPIRWLVALVDSEVLPVEMAGVSA
GRTSRGHRVLHPEPIELATAADYPAALTAAFVLADPEVRRERIRTGIAAVAEQLGAEAAV
PAALLEEVNFLVEWPTAVAGQFESEFLSLPAPVIKTEMITHQRYFPLHQPGDPEALIPRF
ITVSNGDPRYSELIARGNGRVIRARLADGRFFFEEDRKQPLEKFLGKLQSVTFQESLGSV
AERVERLEAIALWLCGHLGLGGEQTRLVARTAHLCKADLATQMVYEFPELQGLVGRDYAR
LDGEEPLVCAGIAEHYQPRNVEDDLPASLTGQVVGIADRLETLVGIFGLGMLPSGSSDPF
ALRRAALTVVRIGWDTDFELDLVEALGFTVELFVSRQLLKQPADTLLEQLCDWFAQRLYG
LLVERDGLDYDLVLAVLGAVDTGYTRRALANLRALKLRLDTLVAARKSGLLAQIYETAVR
VARLAGKAGIGDLTLEHFDAQLVADPAEAALREAVQKFAATAEAAEAQEDYPALLGALGE
LAPQVSCFFDAVMVMVPDETLRTNRLRLLAVIDNNARRCFDVTQVVMAGGQSDNDPIHPK
VRHG
Download sequence
Identical sequences Q7NK34
NP_924592.1.44878 251221.gvip230 gi|37521215|ref|NP_924592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]