SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521227|ref|NP_924604.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521227|ref|NP_924604.1|
Domain Number 1 Region: 6-234
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.46e-67
Family Decarboxylase 0.00000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521227|ref|NP_924604.1|
Sequence length 237
Comment orotidine 5'-phosphate decarboxylase [Gloeobacter violaceus PCC 7421]
Sequence
MGGAERVIVALDLADAQAARALVERAPAVRFWKVGLELFTAAGPGLIEWLKARGCRVFLD
LKFHDIPNTVAGACRAATRLGVDLLTVHATGGQPMLMAAVSACTGEAARLGSPAPAVLAV
TLLTSLDAQLLEQQLLVNVGVSGYVEHLAVLAVSSGVQGVVCSPLETALLRERCGNDFLI
VTPGIRPGGSGEGDQRRTLTPGEAFARGADYLVVGRPVTTAPDPQVAFKAIVAEVGG
Download sequence
Identical sequences Q7NK22
NP_924604.1.44878 gi|37521227|ref|NP_924604.1| 251221.gvip232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]