SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521241|ref|NP_924618.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521241|ref|NP_924618.1|
Domain Number 1 Region: 34-204
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000589
Family GAF domain 0.013
Further Details:      
 
Domain Number 2 Region: 223-431
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000131
Family PP2C-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521241|ref|NP_924618.1|
Sequence length 433
Comment hypothetical protein glr1672 [Gloeobacter violaceus PCC 7421]
Sequence
MSTSPLPKFPTESGQPPPALTLMDLASQLNREQRKIQDLLSSLGFALRSLSNLNQLLELI
PLMAARVTDAEAGAVVLFAEDSQPGLVKLYCPDTKWQPALETILDGLRHLSAEQAAAEER
LGNDPWVVSHSTSILVKSALRGRLYVFSRAVNYQWTEGRQKLLRLVADQTAVAVENDSLN
KELQRKEKLDRELEIGSEIQAQLLPRSCPRINGITLAARCQSADKVGGDYYDFIPITNTN
RWGIVIGDVMGKGVPAGLLMTMTRGMLRAEVLRQDPPALILQHLNHVMFTDLENSNRFVT
LFYSEYDPNTRTLHYSNAAHIPPIYWNASAGETYLLDNPGMLIGLDPESHYQQSSLQLHP
GDAVIYYTDGFTEAADRNNNRFGEQGLNQAVRWAVTHYESPEQILEYLYEQLRQFCPSGR
CGDDMTLIVLKAQ
Download sequence
Identical sequences Q7NK09
gi|37521241|ref|NP_924618.1| 251221.glr1672 NP_924618.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]