SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521254|ref|NP_924631.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521254|ref|NP_924631.1|
Domain Number 1 Region: 15-419
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.46e-92
Family HD domain 0.000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521254|ref|NP_924631.1|
Sequence length 430
Comment hypothetical protein gll1685 [Gloeobacter violaceus PCC 7421]
Sequence
MDGRSGRFSMNLFTRKSRTYHDPIHGAISLSGSDPAEALLIGLIDAPEFQRLRRIRQLDV
AALTFHGAEGSRFTHSLGVLAIARRVFDRLAPRYPMLAPFRAVALCGALLHDIGHGPYSH
ASEHIFDYDHERWTRRILSGSTHIARLLEAFDPQLPSQLCAVLDKTHPVAALTQLVSGQL
DCDRLDYLLRDSYFTGARYGQLDLDRIIHALDYDPPTQSLVLSGRKQMVAIEHYLVVRHF
MYSQVYHHPKNMAARFILQQALALAAHYARRGELEVDEDMKAWLVQEVDRLALPTYLACD
DTVLGYHLHRWRTHPDPILGDLCRRFLDRDLFKTVEVTALGELHRQFVLNRLRAAVAATG
RPPEHYCALQDTQAKGYTLYEQGIFLRDGAQLRELADASLLVRSLIQPEIRLWLVYPREV
QSEVQKLMGS
Download sequence
Identical sequences Q7NJZ6
gi|37521254|ref|NP_924631.1| 251221.gll1685 NP_924631.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]