SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521626|ref|NP_925003.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521626|ref|NP_925003.1|
Domain Number 1 Region: 358-542
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.21e-44
Family Pyruvate oxidase and decarboxylase PP module 0.00012
Further Details:      
 
Domain Number 2 Region: 3-178
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-40
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000378
Further Details:      
 
Domain Number 3 Region: 165-330
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.92e-32
Family Pyruvate oxidase and decarboxylase, middle domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521626|ref|NP_925003.1|
Sequence length 550
Comment indole-3-pyruvate decarboxylase [Gloeobacter violaceus PCC 7421]
Sequence
MASSVLTVGEYLIERLYSHGVHHIFGVPGDYVLGFFKQLCDSPIKVINTCDEQGAGFAAD
AYARVRGLGAVCVTYCVGGLKVANTTAQAYAEKSPVVVISGAPGTNERHKNPLLHHKVRE
FDTQLKVFEQLTVAATVLDDPQTAFCEIDRVFEAALRYRRPVYIELPRNVARATGSACHL
RELPQETSDPATLGEAVKEAVARINASRQPVILAGEELHRFALQPLLAQLIEKTNIPVAS
TILGKSVFPESHPRYLGVYEGAMGREDVRDYVEASDCLVLLGALMTDMNLGIYTANLDPR
RSIYCATEKLTIGYHSYEDVRLQDFAAGLLAGEIERRVDGPTPHPLPLAQFQPVQDRPMT
VLRLFQQLNAFLDDETIVVADPGDALFAGADLFIPGKTRFLAPAYYASLGFAVPAALGAQ
MADARLRPLVLVGDGAFQMSGLELSTIARFGLDPIVVLLNNRGYGTERPMQDGSFNDVLN
WNYSRLPELLGTGRGFEVSTEDQLAAALHEARRHRGSFSLIDVHLEPGDLSPALRRMTDS
MGQRVRPAAV
Download sequence
Identical sequences Q7NIX5
gi|37521626|ref|NP_925003.1| 251221.gll2057 NP_925003.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]