SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521828|ref|NP_925205.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37521828|ref|NP_925205.1|
Domain Number - Region: 45-160
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0542
Family Pectate lyase-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521828|ref|NP_925205.1|
Sequence length 190
Comment hypothetical protein gll2259 [Gloeobacter violaceus PCC 7421]
Sequence
MHYPQKRAIGLALAALTVANLAAIAPARAEETTCTGSLGATTVDNLRVPQGATCTLNGTR
VEGTIYVEANATLKASKVQVKGNVQAENAARVNVLPRSTVGGSIQIVQGGAARIDSVQIA
GDLLFDSNSKSLIAYKNTIGGNLQAFQNNGGLTITANNIDGNLQCKENNPAPVGGENVVQ
GNKEDQCAQL
Download sequence
Identical sequences Q7NIC4
gi|37521828|ref|NP_925205.1| 251221.gll2259 NP_925205.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]