SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521866|ref|NP_925243.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521866|ref|NP_925243.1|
Domain Number 1 Region: 7-333
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.37e-116
Family TK-like PP module 0.00000000548
Further Details:      
 
Domain Number 2 Region: 345-534
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.21e-67
Family TK-like Pyr module 0.00000175
Further Details:      
 
Domain Number 3 Region: 540-669
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.57e-44
Family Transketolase C-terminal domain-like 0.00005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37521866|ref|NP_925243.1|
Sequence length 670
Comment transketolase [Gloeobacter violaceus PCC 7421]
Sequence
MTGTLLDKTAAQLDELSVNTIRFLAVDAVQKANSGHPGLPMGAAPMAYVIWTKFLKHNPT
NPKWFDRDRFILSAGHGSMLLYALLHLTGYDLAIDDLKQFRQLHSRTPGHPENFMTPGVE
VTTGPLGQGLGNGIGIAVAEAHLAARYNRPGHEIIDHTTYAIVSDGDLMEGVASEAASLG
GHLGLGKVIYLYDDNHISIDGETELSFTEDRMQRFDAYGWHTQAVADGNDIAAIEQAIHN
ARAVTDKPSIIAVRTIIGYGSPNKANSHDVHGSPLGGDEVKATKENLKWPLEPEFYIPEE
TLAQFRKAVEAGKEAEADWNARFAAYKAEFPELAAELESLIEGRLPEGWESSLPSFSPAD
KPLATRAASGKVLNAVTAALPGLIGGSADLAPSNNTYVKAFVDFQKATPEGRNFHFGVRE
HGMGAVMNGMAMHGGLKVYGGTFLIFMDYMKGAVRVAALSHSPVVYVFTHDSIGLGEDGP
THQPVEQILTLRATPQLTVIRPGDAVETVGAWKVAIESNRDPVALILTRQNLPIQPGSTV
EAVAKGAYTLVEADNPEIILIGTGSEVQLVVEAQKQLAEQGIAARVVSFPSWELFEAQPQ
EYKDSVLTPGVKRLAVEAGTSLGWHKYVGLEGAVIGVDRYGASAPIKAVMPEYGFTIDNV
VAHALKVLGR
Download sequence
Identical sequences Q7NI86
251221.glr2297 gi|37521866|ref|NP_925243.1| NP_925243.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]