SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37521973|ref|NP_925350.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521973|ref|NP_925350.1|
Domain Number 1 Region: 175-253
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 1.44e-23
Family TonB 0.022
Further Details:      
 
Weak hits

Sequence:  gi|37521973|ref|NP_925350.1|
Domain Number - Region: 158-170
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000968
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521973|ref|NP_925350.1|
Sequence length 256
Comment hypothetical protein glr2404 [Gloeobacter violaceus PCC 7421]
Sequence
MQPGSLWQRTPSDDDGGLKLILACVVGSALLHAGLFALKLPEPKPPEIPKAQKMVMVETA
PKLPPPKPKVEPPKPKPPEPKSFSRKPVPKKSAPQKAKASRTILSSKAVSADAGTVSENQ
LAGSRGTGYGTEKGDDFGSIAPLGVDGGSGGTDVVETPPPPPPPPPPLVNARPKGAVQPE
YPEIAQQNNWEGRVIVKAYINADGSVGEVQVAKSSGHSELDNAALAAVRNTKFEPARRGE
ESVGAWVRIPVTFSLQ
Download sequence
Identical sequences Q7NHY1
NP_925350.1.44878 251221.glr2404 gi|37521973|ref|NP_925350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]