SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37522053|ref|NP_925430.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522053|ref|NP_925430.1|
Domain Number 1 Region: 52-212,313-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.73e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37522053|ref|NP_925430.1|
Sequence length 514
Comment hypothetical protein gll2484 [Gloeobacter violaceus PCC 7421]
Sequence
MPLSEAILTIQDRDNLQRAERLWQQLRSPGPRAAEAVVLRSTGRLGAVDWDVIVAGGTLG
IMLAAALARRGLRVALIERGALVGRAQEWNVSRPDLDIFVKLGLLSADELESAIASRSAG
ARVAIAGGTPVPVQGVLDVGVDPVYLLAVLKERFLVAGGALFEHAPFVRAAVHPDGVAVA
AGEKRLSGRLLIDAMGHFSPIVRQARGAARPDGVCLVVGSCAQGFTADNQTDLIASITPV
LNRCQYLWEAFPARDGRTTYLFTYLDAHPERLGLGELFEEYLRLLPAYQGTPLDRLRFRR
LLFGLFPSYRQALDLTGWDRILAVGDSAGNQSPLSFGGFGAMLRHLGRLEAGTAEALAAG
CLGGRDLQRLQPYQPNLAVTWLFQKAMSVGVEQNVNPDRINRLLATVFAQMDALGDGVLR
PFLQDVVRLDALSVTLARVALVDPGLVLALVGHLGPGALVEWTGHYLNLVGYTALDRLGS
ILHGPLESLPPPARYRANRRLEAWRYGSGHDLME
Download sequence
Identical sequences Q7NHQ1
251221.gll2484 NP_925430.1.44878 gi|37522053|ref|NP_925430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]